PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G019800.1.p
Common NameSETIT_026524mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 379aa    MW: 41091.2 Da    PI: 6.8625
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G019800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.78.3e-3195148255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH +F++av++LGG+++AtPk +l+lm+vkgL++ hvkSHLQ+YR+
  Seita.8G019800.1.p  95 PRLRWTPELHLCFLRAVDRLGGQDRATPKLVLQLMNVKGLSIGHVKSHLQMYRS 148
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.91591151IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2991149IPR009057Homeodomain-like
SuperFamilySSF466891.72E-1592149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-2394150IPR006447Myb domain, plants
PfamPF002498.2E-996147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MHPASIHPSC MEASGKGLDS STMDHQLQSS SGEAEEEEED AAADMPPGGG RDGSSASNSS  60
TVELLDEAGG GGGDSSRNPS SSSSSVRPYV RSKNPRLRWT PELHLCFLRA VDRLGGQDRA  120
TPKLVLQLMN VKGLSIGHVK SHLQMYRSKK IDDSGQVIGG SWRDDHELQE GGRQVYNLGR  180
LSLHHAQTTG ATTLLSARFG AWPHYWNWLH GHHHLLGSKP YYSSAAEAGV FLTTRAHQYV  240
ARATCSSAPA SILQGRSSYH QNDQFIRPLL RDEDSGNHNH HDPLDLELAL DIGPRRQDNK  300
RIKRSSSGCS WGREDEENAA RDNDQQVLES ATDTGLSLSL FSSYPPPFVR TGSGGALGVN  360
MDKGKAHPTR TSTLDLTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684401e-102BT068440.1 Zea mays full-length cDNA clone ZM_BFb0191O11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703832.10.0PREDICTED: uncharacterized protein LOC101780885
TrEMBLK3ZIX10.0K3ZIX1_SETIT; Uncharacterized protein
STRINGSi026524m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-39G2-like family protein